PDB entry 1snq

View 1snq on RCSB PDB site
Description: protein stability in staphylococcal nuclease
Deposited on 1996-07-06, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1snq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1snq_ (-)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhgkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqll
    rkseaqakkeklniws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snq_ (-)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetvekygpeasaftkkmvenakk
    ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkseaq
    akkeklniws