PDB entry 1sno

View 1sno on RCSB PDB site
Description: protein stability in staphylococcal nuclease
Class: hydrolase
Keywords: hydrolase, nuclease, endonuclease, calcium, signal
Deposited on 1996-07-06, released 1997-02-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (123)
    Domains in SCOPe 2.04: d1snoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snoA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqllrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snoA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqll
    rkseaqakkeklniws