PDB entry 1snm

View 1snm on RCSB PDB site
Description: active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1990-02-15, released 1991-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermonuclease precursor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (42)
    Domains in SCOPe 2.06: d1snma_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snmA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpdtkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snmA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpdtkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniwse