PDB entry 1snl

View 1snl on RCSB PDB site
Description: NMR Solution Structure of the Calcium-binding Domain of Nucleobindin (CALNUC)
Class: metal binding protein
Keywords: ef-hand, calcium-binding, metal binding protein
Deposited on 2004-03-11, released 2004-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleobindin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUCB1, NUC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1snla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snlA (A:)
    gshmlkevweeldgldpnrfnpktffilhdinsdgvldeqelealftkelekvydpknee
    ddmremeeerlrmrehvmknvdtnqdrlvtleeflastqrkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snlA (A:)
    lkevweeldgldpnrfnpktffilhdinsdgvldeqelealftkelekvydpkneeddmr
    emeeerlrmrehvmknvdtnqdrlvtleeflastqrkef