PDB entry 1snd

View 1snd on RCSB PDB site
Description: staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate
Class: hydrolase
Keywords: hydrolase, nuclease, endonuclease
Deposited on 1996-08-23, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.176
AEROSPACI score: -1.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1snda_
  • Chain 'B':
    Compound: staphylococcal nuclease dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sndb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sndA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlr
    kseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sndA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlrkseaqa
    kkeklniws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sndB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlr
    kseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sndB (B:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvaytheqhlrkseaqa
    kkeklniws