PDB entry 1sn7

View 1sn7 on RCSB PDB site
Description: kumamolisin-as, apoenzyme
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-03-10, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kumamolisin-As
    Species: Alicyclobacillus sendaiensis [TaxId:192387]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sn7a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sn7A (A:)
    aaptaytpldvaqayqfpegldgqgqciaiielgggydeaslaqyfaslgvpapqvvsvs
    vdgasnqptgdpsgpdgeveldievagalapgakfavyfapntdagfldaittaihdptl
    kpsvvsiswggpedswtsaaiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
    paaspyvlacggtrlvasggriaqetvwndgpdggatgggvsrifplpawqehanvppsa
    npgassgrgvpdlagnadpatgyevvidgeatviggtsavaplfaalvarinqklgkavg
    ylnptlyqlpadvfhditegnndianraqiyqagpgwdpctglgspigvrllqallpsas
    qpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sn7A (A:)
    taytpldvaqayqfpegldgqgqciaiielgggydeaslaqyfaslgvpapqvvsvsvdg
    asnqptgdpsgpdgeveldievagalapgakfavyfapntdagfldaittaihdptlkps
    vvsiswggpedswtsaaiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdfpaa
    spyvlacggtrlvasggriaqetvwndgpdggatgggvsrifplpawqehanvppsanpg
    assgrgvpdlagnadpatgyevvidgeatviggtsavaplfaalvarinqklgkavgyln
    ptlyqlpadvfhditegnndianraqiyqagpgwdpctglgspigvrllqallps