PDB entry 1sn5

View 1sn5 on RCSB PDB site
Description: Crystal Structure of Sea Bream Transthyretin in complex with Triiodothyronine at 1.90A Resolution
Class: transport protein
Keywords: transport protein
Deposited on 2004-03-10, released 2004-08-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PTT3 (Start-129)
      • conflict (105)
    Domains in SCOPe 2.03: d1sn5a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PTT3
      • conflict (105)
    Domains in SCOPe 2.03: d1sn5b_
  • Chain 'C':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PTT3
      • conflict (105)
    Domains in SCOPe 2.03: d1sn5c_
  • Chain 'D':
    Compound: Transthyretin
    Species: Sparus aurata [TaxId:8175]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PTT3
      • conflict (105)
    Domains in SCOPe 2.03: d1sn5d_
  • Heterogens: SO4, T3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sn5A (A:)
    tptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihn
    liteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsyt
    ttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sn5A (A:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssvhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sn5B (B:)
    tptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihn
    liteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsyt
    ttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sn5B (B:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sn5C (C:)
    tptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihn
    liteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsyt
    ttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sn5C (C:)
    plmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvyr
    vefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sn5D (D:)
    tptdkhggsdtrcplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihn
    liteqqfpagvyrvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsyt
    ttavvssvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sn5D (D:)
    cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
    rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs