PDB entry 1smw

View 1smw on RCSB PDB site
Description: Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
Class: electron transport
Keywords: electron transport
Deposited on 2004-03-09, released 2004-03-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.183
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-53)
      • engineered (40)
    Domains in SCOPe 2.02: d1smwa_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smwA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcpacgvgkdqfeevee