PDB entry 1smv

View 1smv on RCSB PDB site
Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus
Class: Virus
Keywords: COAT PROTEIN (VIRAL), Icosahedral virus
Deposited on 1995-06-16, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sesbania mosaic virus coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EB06 (Start-264)
      • conflict (71)
      • conflict (77)
      • conflict (80)
      • conflict (110)
      • conflict (154)
      • conflict (178-179)
      • conflict (196)
      • conflict (223)
      • conflict (249)
    Domains in SCOPe 2.07: d1smva_
  • Chain 'B':
    Compound: sesbania mosaic virus coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EB06 (Start-264)
      • conflict (71)
      • conflict (77)
      • conflict (80)
      • conflict (110)
      • conflict (154)
      • conflict (178-179)
      • conflict (196)
      • conflict (223)
      • conflict (249)
    Domains in SCOPe 2.07: d1smvb_
  • Chain 'C':
    Compound: sesbania mosaic virus coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EB06 (Start-264)
      • conflict (71)
      • conflict (77)
      • conflict (80)
      • conflict (110)
      • conflict (154)
      • conflict (178-179)
      • conflict (196)
      • conflict (223)
      • conflict (249)
    Domains in SCOPe 2.07: d1smvc_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smvA (A:)
    akrlsiqqlakaiantletppqpkagrrrnrrrqrsavqqlppiqagismapsaqgamvr
    irnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswls
    vrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinns
    rcsdtstaisttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgsss
    tavaagriydtytiqmieptasalnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smvA (A:)
    gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
    ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
    tytiqmieptasalnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smvB (B:)
    akrlsiqqlakaiantletppqpkagrrrnrrrqrsavqqlppiqagismapsaqgamvr
    irnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswls
    vrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinns
    rcsdtstaisttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgsss
    tavaagriydtytiqmieptasalnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smvB (B:)
    gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
    ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
    tytiqmieptasalnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1smvC (C:)
    akrlsiqqlakaiantletppqpkagrrrnrrrqrsavqqlppiqagismapsaqgamvr
    irnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswls
    vrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinns
    rcsdtstaisttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgsss
    tavaagriydtytiqmieptasalnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smvC (C:)
    qagismapsaqgamvrirnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgt
    wlrgvadnwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvs
    gqvwsgsaglcfinnsrcsdtstaisttldvselgkkwypyktsadyatavgvdvniatd
    lvparlvialldgssstavaagriydtytiqmieptasalnl