PDB entry 1smv

View 1smv on RCSB PDB site
Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus
Deposited on 1995-06-16, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.227
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1smva_
  • Chain 'B':
    Domains in SCOP 1.55: d1smvb_
  • Chain 'C':
    Domains in SCOP 1.55: d1smvc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smvA (A:)
    gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
    ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
    tytiqmieptasalnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smvB (B:)
    gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
    ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
    tytiqmieptasalnl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smvC (C:)
    qagismapsaqgamvrirnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgt
    wlrgvadnwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvs
    gqvwsgsaglcfinnsrcsdtstaisttldvselgkkwypyktsadyatavgvdvniatd
    lvparlvialldgssstavaagriydtytiqmieptasalnl