PDB entry 1smr

View 1smr on RCSB PDB site
Description: The 3-d structure of mouse submaxillary renin complexed with a decapeptide inhibitor ch-66 based on the 4-16 fragment of rat angiotensinogen
Class: hydrolase/hydrolase inhibitor
Keywords: ASPARTIC PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1992-03-11, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: Mus musculus [TaxId:10090]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00796 (0-334)
      • conflict (109)
      • conflict (177)
    Domains in SCOPe 2.08: d1smra_
  • Chain 'B':
    Compound: inhibitor ch-66
    Database cross-references and differences (RAF-indexed):
    • PDB 1SMR (0-8)
  • Chain 'C':
    Compound: renin
    Species: Mus musculus [TaxId:10090]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00796 (0-334)
      • conflict (109)
      • conflict (177)
    Domains in SCOPe 2.08: d1smrc_
  • Chain 'D':
    Compound: inhibitor ch-66
    Database cross-references and differences (RAF-indexed):
    • PDB 1SMR (0-8)
  • Chain 'E':
    Compound: renin
    Species: Mus musculus [TaxId:10090]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00796 (0-334)
      • conflict (109)
      • conflict (177)
    Domains in SCOPe 2.08: d1smre_
  • Chain 'F':
    Compound: inhibitor ch-66
    Database cross-references and differences (RAF-indexed):
    • PDB 1SMR (0-8)
  • Chain 'G':
    Compound: renin
    Species: Mus musculus [TaxId:10090]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00796 (0-334)
      • conflict (109)
      • conflict (177)
    Domains in SCOPe 2.08: d1smrg_
  • Chain 'H':
    Compound: inhibitor ch-66
    Database cross-references and differences (RAF-indexed):
    • PDB 1SMR (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smrA (A:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
    ppptgpvwvlgatfirkfytefdrhnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smrA (A:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
    gpvwvlgatfirkfytefdrhnnrigfalar
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1smrC (C:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
    ppptgpvwvlgatfirkfytefdrhnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smrC (C:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
    gpvwvlgatfirkfytefdrhnnrigfalar
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1smrE (E:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
    ppptgpvwvlgatfirkfytefdrhnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smrE (E:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
    gpvwvlgatfirkfytefdrhnnrigfalar
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1smrG (G:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
    ppptgpvwvlgatfirkfytefdrhnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smrG (G:)
    tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
    yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
    fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
    qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
    gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
    gpvwvlgatfirkfytefdrhnnrigfalar
    

  • Chain 'H':
    No sequence available.