PDB entry 1smo

View 1smo on RCSB PDB site
Description: Crystal Structure of Human Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.47 .
Class: immune system
Keywords: activating receptors, TREM-1, innate immune system receptor, IMMUNE SYSTEM
Deposited on 2004-03-09, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.193
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: trem-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smoa_
  • Chain 'B':
    Compound: triggering receptor expressed on myeloid cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: trem-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smob_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smoA (A:)
    atklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpv
    qvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtkgfsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smoA (A:)
    atklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpv
    qvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smoB (B:)
    atklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpv
    qvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtkgfsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smoB (B:)
    eekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpvqvgri
    iledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtk