PDB entry 1smk

View 1smk on RCSB PDB site
Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Class: oxidoreductase
Keywords: tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase
Deposited on 2004-03-09, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smka1, d1smka2
  • Chain 'B':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkb1, d1smkb2
  • Chain 'C':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkc1, d1smkc2
  • Chain 'D':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkd1, d1smkd2
  • Chain 'E':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smke1, d1smke2
  • Chain 'F':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkf1, d1smkf2
  • Chain 'G':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkg1, d1smkg2
  • Chain 'H':
    Compound: Malate dehydrogenase, glyoxysomal
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smkh1, d1smkh2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smkA (A:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkA (A:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smkB (B:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkB (B:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1smkC (C:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkC (C:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1smkD (D:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkD (D:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1smkE (E:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkE (E:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1smkF (F:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkF (F:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1smkG (G:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkG (G:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1smkH (H:)
    rakggapgfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgav
    vrgflgqqqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccprai
    vnlisnpvnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpv
    vgghagvtilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaav
    kfadaclrglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyerigl
    ekakkelagsiekgvsfirshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smkH (H:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs