PDB entry 1smg

View 1smg on RCSB PDB site
Description: calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures
Class: calcium-binding protein
Keywords: calcium-binding protein, muscle protein, troponin c
Deposited on 1997-02-04, released 1997-08-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02588 (0-89)
      • engineered (40)
    Domains in SCOPe 2.04: d1smga_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smgA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkalgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda