PDB entry 1smf

View 1smf on RCSB PDB site
Description: Studies on an artificial trypsin inhibitor peptide derived from the mung bean inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1992-10-24, released 1994-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1smfe_
  • Chain 'I':
    Compound: Bowman-Birk type trypsin inhibitor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1smfi_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smfE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1smfI (I:)
    epccdscrctksippechcani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smfI (I:)
    ctksippec