SCOP 1.73: Structural Classification of Proteins

PDB entry 1smf

View 1smf on RCSB PDB site
Description: studies on an artificial trypsin inhibitor peptide derived from the mung bean inhibitor
Class: complex(proteinase/inhibitor)
Keywords: complex(proteinase/inhibitor)
Deposited on 1992-10-24, released 1994-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'E':
Compound: Trypsin
Database cross-references and differences (RAF-indexed):
- Uniprot P00760 (0-222)
Domains in SCOP 1.73: d1smfe_
Chain 'I':
Compound: Bowman-Birk type trypsin inhibitor
Database cross-references and differences (RAF-indexed):
- Uniprot P01062
Domains in SCOP 1.73: d1smfi_
Heterogens: CA, HOH

PDB Chain Sequences:

Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)

>1smfE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Chain 'I':
Sequence, based on SEQRES records: (download)
```
>1smfI (I:)
epccdscrctksippechcani
```
Sequence, based on observed residues (ATOM records): (download)
```
>1smfI (I:)
ctksippec
```