PDB entry 1sme

View 1sme on RCSB PDB site
Description: plasmepsin II, a hemoglobin-degrading enzyme from plasmodium falciparum, in complex with pepstatin a
Class: aspartyl protease
Keywords: aspartyl proteinase, aspartic proteinase, hydrolase
Deposited on 1996-06-11, released 1997-01-11
The last revision prior to the SCOP 1.75 freeze date was dated 1997-01-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1smea_
  • Chain 'B':
    Compound: plasmepsin II
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1smeb_
  • Heterogens: IHN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smeA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smeB (B:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl