PDB entry 1sme

View 1sme on RCSB PDB site
Description: plasmepsin II, a hemoglobin-degrading enzyme from plasmodium falciparum, in complex with pepstatin a
Class: hydrolase/hydrolase inhibitor
Keywords: ASPARTYL PROTEINASE, ASPARTIC PROTEINASE, ASPARTYL PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1996-06-11, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smea_
  • Chain 'B':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smeb_
  • Chain 'C':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1SME (0-5)
  • Chain 'D':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1SME (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smeA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smeB (B:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.