PDB entry 1smb

View 1smb on RCSB PDB site
Description: Crystal Structure of Golgi-Associated PR-1 protein
Deposited on 2004-03-08, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1smba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smbA (A:)
    mgksaskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessr
    gqcgenlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgka
    sasdgssfvvaryfpagnvvnegffeenvlppkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smbA (A:)
    saskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessrgqc
    genlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgkasas
    dgssfvvaryfpagnvvnegffeenvlpp