PDB entry 1smb

View 1smb on RCSB PDB site
Description: Crystal Structure of Golgi-Associated PR-1 protein
Class: unknown function
Keywords: alpha-beta-alpha, unknown function
Deposited on 2004-03-08, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17kD fetal brain protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CAC12812
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4G4
      • modified residue (31)
      • modified residue (62)
    Domains in SCOPe 2.07: d1smba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smbA (A:)
    mgksaskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessr
    gqcgenlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgka
    sasdgssfvvaryfpagnvvnegffeenvlppkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smbA (A:)
    saskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessrgqc
    genlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgkasas
    dgssfvvaryfpagnvvnegffeenvlpp