PDB entry 1sma

View 1sma on RCSB PDB site
Description: crystal structure of a maltogenic amylase
Deposited on 1999-04-21, released 2000-04-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smaA (A:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smaB (B:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw