PDB entry 1sma

View 1sma on RCSB PDB site
Description: crystal structure of a maltogenic amylase
Class: hydrolase
Keywords: amylase, transglycosylation, cyclodextrin, hydrolase
Deposited on 1999-04-21, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltogenic amylase
    Species: Thermus sp. IM6501 [TaxId:75891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smaa1, d1smaa2, d1smaa3
  • Chain 'B':
    Compound: maltogenic amylase
    Species: Thermus sp. IM6501 [TaxId:75891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smab1, d1smab2, d1smab3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smaA (A:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smaB (B:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw