PDB entry 1sm9

View 1sm9 on RCSB PDB site
Description: Crystal Structure Of An Engineered K274RN276D Double Mutant of Xylose Reductase From Candida Tenuis Optimized To Utilize NAD
Class: oxidoreductase
Keywords: xylose metabolism, coenzyme specificity, aldo-keto reductase, beta-alpha-barrel, AKR2B5, OXIDOREDUCTASE
Deposited on 2004-03-08, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Database cross-references and differences (RAF-indexed):
    • GB AAC25601 (Start-321)
      • engineered (273)
      • engineered (275)
    Domains in SCOPe 2.07: d1sm9a_
  • Chain 'B':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Database cross-references and differences (RAF-indexed):
    • GB AAC25601 (Start-321)
      • engineered (273)
      • engineered (275)
    Domains in SCOPe 2.07: d1sm9b_
  • Chain 'C':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Database cross-references and differences (RAF-indexed):
    • GB AAC25601 (Start-321)
      • engineered (273)
      • engineered (275)
    Domains in SCOPe 2.07: d1sm9c_
  • Chain 'D':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Database cross-references and differences (RAF-indexed):
    • GB AAC25601 (Start-321)
      • engineered (273)
      • engineered (275)
    Domains in SCOPe 2.07: d1sm9d_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sm9A (A:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm9A (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sm9B (B:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm9B (B:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sm9C (C:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm9C (C:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sm9D (D:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm9D (D:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsdlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv