PDB entry 1slu

View 1slu on RCSB PDB site
Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin
Class: complex (serine protease/inhibitor)
Keywords: serine protease, inhibitor, complex, metal binding sites, protein engineering, protease-substrate interactions, metalloproteins, complex (serine protease-inhibitor) complex
Deposited on 1996-02-07, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (85)
    Domains in SCOPe 2.07: d1slua_
  • Chain 'B':
    Compound: anionic trypsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (122)
      • engineered (130)
    Domains in SCOPe 2.07: d1slub_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sluA (A:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sluA (A:)
    iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
    dyyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
    aeekidnavvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sluB (B:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wghtlssgvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sluB (B:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvkvatvalpsscapagtqclisgwght
    lvnhpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngel
    qgivswgygcalpdnpgvytkvcnyvdwiqdtiaan