PDB entry 1slt

View 1slt on RCSB PDB site
Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein
Deposited on 1993-10-20, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1slta_
  • Chain 'B':
    Domains in SCOP 1.59: d1sltb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sltA (A:)
    cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
    skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
    aggdfkikcvafe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sltB (B:)
    glvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcns
    kdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainylsa
    ggdfkikcvafe