PDB entry 1slm

View 1slm on RCSB PDB site
Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme
Deposited on 1995-08-03, released 1996-12-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-17, with a file datestamp of 1996-12-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1slm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1slm_ (-)
    lvqkylenyydlkkdvkqfvrrkdsgpvvkkiremqkflglevtgkldsdtlevmrkprc
    gvpdvghfrtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrl
    yegeadimisfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnl
    flvaaheighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1slm_ (-)
    lvqkylenyydlkkdsgpvvkkiremqkflglevtgkldsdtlevmrkprcgvpdvghfr
    tfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimi
    sfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheig
    hslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp