PDB entry 1sll

View 1sll on RCSB PDB site
Description: sialidase l from leech macrobdella decora
Deposited on 1997-10-14, released 1998-12-16
The last revision prior to the SCOP 1.55 freeze date was dated 1998-12-16, with a file datestamp of 1998-12-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sll_ (-)
    ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
    tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
    nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
    alsdeeliqatgvttygenifyagdvtesnyfripslltlstgtvisaadaryggthdsk
    skiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlle
    dkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi
    yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf
    kafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvpl
    yskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktylrtgsnciaev
    tsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwi
    glvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelh
    lkdilkfekysiseltgqa