PDB entry 1slj

View 1slj on RCSB PDB site
Description: Solution structure of the S1 domain of RNase E from E. coli
Class: hydrolase
Keywords: OB-fold, RNA-binding, HYDROLASE
Deposited on 2004-03-05, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease E
  Species: Escherichia coli [TaxId:562]
  Gene: RNE, AMS, HMP1, B1084
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21513 (5-95)
    • cloning artifact (0-4)
  Domains in SCOPe 2.07: d1slja1, d1slja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sljA (A:)
  gshmleqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpn
  ikdvlregqevivqidkeergnkgaalttfislags