PDB entry 1slj

View 1slj on RCSB PDB site
Description: solution structure of the s1 domain of rnase e from e. coli
Deposited on 2004-03-05, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1slja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sljA (A:)
    gshmleqkkaniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpn
    ikdvlregqevivqidkeergnkgaalttfislags