PDB entry 1sli

View 1sli on RCSB PDB site
Description: leech intramolecular trans-sialidase complexed with dana
Deposited on 1998-03-28, released 1999-04-20
The last revision prior to the SCOP 1.69 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sli_ (-)
    ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
    tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
    nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
    alsdeeliqatgvttygenifyagdvtesnyfripslltlstgtvisaadaryggthdsk
    skiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlle
    dkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi
    yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf
    kafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvpl
    yskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktylrtgsnciaev
    tsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwi
    glvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelh
    lkdilkfekysiseltgqa