PDB entry 1sld

View 1sld on RCSB PDB site
Description: streptavidin, ph 7.5, bound to cyclic disulfide-bonded peptide ligand ac-chpqfc-nh2
Class: complex(biotin-binding protein/peptide)
Keywords: complex(biotin-binding protein/peptide)
Deposited on 1995-03-10, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sldb_
  • Chain 'P':
    Compound: cyclo-ac-chpqfc-nh2
    Database cross-references and differences (RAF-indexed):
    • PDB 1SLD
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1sldB (B:)
dpskdskaqvsaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
kstlvghdtftkvkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1sldB (B:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

  • Chain 'P':
    No sequence available.