PDB entry 1slc

View 1slc on RCSB PDB site
Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
Deposited on 1994-03-12, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.15 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1slca_
  • Chain 'B':
    Domains in SCOP 1.63: d1slcb_
  • Chain 'C':
    Domains in SCOP 1.63: d1slcc_
  • Chain 'D':
    Domains in SCOP 1.63: d1slcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slcA (A:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slcB (B:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slcC (C:)
    cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
    skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
    aggdfkikcvafe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slcD (D:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe