PDB entry 1slb

View 1slb on RCSB PDB site
Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
Deposited on 1994-03-12, released 1995-01-26
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1slba_
  • Chain 'B':
    Domains in SCOP 1.59: d1slbb_
  • Chain 'C':
    Domains in SCOP 1.59: d1slbc_
  • Chain 'D':
    Domains in SCOP 1.59: d1slbd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slbA (A:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slbB (B:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slbC (C:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1slbD (D:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe