PDB entry 1sl8

View 1sl8 on RCSB PDB site
Description: Calcium-loaded apo-aequorin from Aequorea victoria
Deposited on 2004-03-05, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.217
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sl8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sl8A (A:)
    msvkltpdfdnpkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrh
    kdaveaffggagmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidk
    dqngaisldewkaytksagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
    aceklyggavp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl8A (A:)
    npkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrhkdaveaffgg
    agmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidkdqngaislde
    wkaytksagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpaceklyggav
    p