PDB entry 1sl6

View 1sl6 on RCSB PDB site
Description: Crystal Structure of a fragment of DC-SIGNR (containg the carbohydrate recognition domain and two repeats of the neck) complexed with Lewis-x.
Class: sugar binding protein
Keywords: dc-signr, c-type lectin, sugar binding protein
Deposited on 2004-03-05, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6a_
  • Chain 'B':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6b_
  • Chain 'C':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6c_
  • Chain 'D':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6d_
  • Chain 'E':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6e_
  • Chain 'F':
    Compound: C-type lectin DC-SIGNR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAG13815
    Domains in SCOPe 2.08: d1sl6f_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sl6A (A:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6A (A:)
    peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sl6B (B:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6B (B:)
    peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sl6C (C:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6C (C:)
    peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sl6D (D:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6D (D:)
    peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sl6E (E:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6E (E:)
    peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sl6F (F:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl6F (F:)
    peksklqeiyqeltqlkaaqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
    hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
    sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr