PDB entry 1sl5

View 1sl5 on RCSB PDB site
Description: Crystal Structure of DC-SIGN carbohydrate recognition domain complexed with LNFP III (Dextra L504).
Class: sugar binding protein
Keywords: dc-sign, c-type lectin, sugar binding protein
Deposited on 2004-03-05, released 2004-06-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mDC-SIGN1B type I isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAK91854
    Domains in SCOPe 2.01: d1sl5a_
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sl5A (A:)
erlchpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssr
snrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkc
nlakfwickksaascsrde

    Sequence, based on observed residues (ATOM records): (download) 
    >1sl5A (A:)
chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
kfwickksaas