PDB entry 1sl3

View 1sl3 on RCSB PDB site
Description: crystal structue of Thrombin in complex with a potent P1 heterocycle-Aryl based inhibitor
Class: blood clotting,hydrolase/inhibitor
Keywords: thrombin inhibitor complex, BLOOD CLOTTING, HYDROLASE-INHIBITOR COMPLEX
Deposited on 2004-03-05, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sl3a_
  • Chain 'B':
    Compound: hirudin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28504 (0-9)
      • insertion (10)
  • Heterogens: 170, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sl3A (A:)
    dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
    vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
    kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sl3A (A:)
    dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
    drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
    nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
    vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
    givswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'B':
    No sequence available.