PDB entry 1sky

View 1sky on RCSB PDB site
Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-ATPase from the thermophilic bacillus ps3
Class: ATP synthase
Keywords: ATP synthase, f1fo ATP synthase, f1-ATPase, alpha3beta3 subcomplex of f1-ATPase, hydrolase
Deposited on 1997-02-26, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.222
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: f1-ATPase
    Species: Bacillus sp. [TaxId:2334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1skyb1, d1skyb2, d1skyb3
  • Chain 'E':
    Compound: f1-ATPase
    Species: Bacillus sp. [TaxId:2334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1skye1, d1skye2, d1skye3
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1skyB (B:)
    msiraeeisalikqqienyesqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavm
    gmalnleennvgivilgpytgikegdevrrtgrimevpvgetligrvvnplgqpvdglgp
    vettetrpiesrapgvmdrrsvheplqtgikaidalvpigrgqreliigdrqtgktsvai
    dtiinqkdqnmiciyvaigqkestvatvvetlakhgapdytivvtasasqpapllflapy
    agvamgeyfmimgkhvlvviddlskqaaayrqlslllrrppgreaypgdifylhsrller
    aaklsdakgggsltalpfvetqagdisayiptnvisitdgqiflqsdlffsgvrpainag
    lsvsrvggaaqikamkkvagtlrldlaayreleafaqfgsdldkatqanvargartvevl
    kqdlhqpipvekqvliiyaltrgflddipvedvrrfekefylwldqngqhllehirttkd
    lpneddlnqaieafkktfvvsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skyB (B:)
    sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt
    gikegdevrrtgrimevpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrr
    svheplqtgikaidalvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigq
    kestvatvvetlakhgapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvvi
    ddlskqaaayrqlslllrrppgreaypgdifylhsrlleraaklsdakgggsltalpfve
    tqagdisayiptnvisitdgqiflqsdlffsgvrpainaglsvsrvggaaqikamkkvag
    tlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqvliiyaltrg
    flddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieafkktfvvsq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1skyE (E:)
    mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
    tiamastdglirgmevidtgapisvpvgqvtlgrvfnvlgepidlegdipadarrdpihr
    papkfeelateveiletgikvvdllapyikggkiglfggagvgktvliqelihniaqehg
    gisvfagvgertregndlyhemkdsgvisktamvfgqmneppgarmrvaltgltmaeyfr
    deqgqdgllfidnifrftqagsevsallgrmpsaigyqptlatemgqlqeritstakgsi
    tsiqaiyvpaddytdpapattfshldattnlerklaemgiypavdplvstsralapeivg
    eehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhvaeqf
    tgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamgvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skyE (E:)
    mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
    tiamastdglirgmevidtgapisvpvgqvtlgrvfnvlgepidlegdipadarrdpihr
    papkfeelateveiletgikvvdllapyikggkiglfggagvgktvliqelihniaqehg
    gisvfagvgertregndlyhemkdsgvisktamvfgqmneppgarmrvaltgltmaeyfr
    deqgqdgllfidnifrftqagsevsallgrmpsaigyqptlatemgqlqeritstakgsi
    tsiqaiyvpaddytdpapattfshldattnlerklaemgiypavdplvstsralapeivg
    eehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhvaeqf
    tgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamg