PDB entry 1skx

View 1skx on RCSB PDB site
Description: Structural Disorder in the Complex of Human PXR and the Macrolide Antibiotic Rifampicin
Class: transcription
Keywords: Pregnane X Receptor, Rifampicin, Nuclear Receptor, Ligand Binding Domain, TRANSCRIPTION
Deposited on 2004-03-05, released 2005-03-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor pxr
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1skxa1
  • Heterogens: RFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1skxA (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skxA (A:)
    lteeqrmmirelmdaqmktfdttfshfknfrlpgvkvslqlrgedgsvwnykppifsllp
    hmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtwec
    grlsyclelllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqf
    aitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelf
    gi