PDB entry 1skw

View 1skw on RCSB PDB site
Description: Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
Class: transferase/electron transport/DNA
Keywords: DNA polymerase, fidelity, lesion bypass, thymine dimer, open, close, TRANSFERASE/ELECTRON TRANSPORT/DNA COMPLEX
Deposited on 2004-03-05, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1skwa1, d1skwa2
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1skwb_
  • Chain 'P':
    Compound: 5'-d(*cp*gp*ap*ap*ap*ap*cp*gp*ap*c*gp*gp*cp*cp*ap*gp*tp*gp*cp*cp*(2dt))-3'
  • Chain 'T':
    Compound: 5'-d(*cp*cp*cp*(ttd)p*ap*gp*gp*cp*ap*cp*tp*gp*gp*cp*cp*gp*tp*cp*gp*tp*tp*tp*tp*cp*g)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1skwA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skwA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpkncel
    dtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvd
    dpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafp
    nlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclahfmarfdnge
    yaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagkergkelkkkf
    lentpaiaalresiqqtlvekwkrrwikgldgrkvhvrsphaalntllqsagalicklwi
    ikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnf
    rclldtegkmgpnwaich
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1skwB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skwB (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.