PDB entry 1skt

View 1skt on RCSB PDB site
Description: solution structure of apo n-domain of troponin c, nmr, 40 structures
Class: calcium-binding protein
Keywords: calcium-binding protein, ef-hand, low-temperature
Deposited on 1998-04-06, released 1998-12-09
The last revision prior to the SCOP 1.73 freeze date was dated 1999-06-21, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin-c
    Species: GALLUS GALLUS
    Gene: NTNC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1skta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sktA (A:)
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda