PDB entry 1skt

View 1skt on RCSB PDB site
Description: solution structure of apo n-domain of troponin c, nmr, 40 structures
Deposited on 1998-04-06, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-21, with a file datestamp of 1999-06-20.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1skt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1skt_ (-)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
  iieevdedgsgtidfeeflvmmvrqmkeda