PDB entry 1skm

View 1skm on RCSB PDB site
Description: HhaI methyltransferase in complex with DNA containing an abasic south carbocyclic sugar at its target site
Class: transferase/DNA
Keywords: PROTEIN-DNA COMPLEX Containing Constrained Abasic Unnatural base
Deposited on 2004-03-05, released 2004-08-24
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1skma_
  • Chain 'C':
    Compound: 5'-d(*tp*cp*cp*ap*tp*gp*cp*gp*cp*tp*gp*ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(*t*gp*tp*cp*ap*gp*(hcx)p*gp*cp*ap*tp*gp*g)-3'
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1skmA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.