PDB entry 1skg

View 1skg on RCSB PDB site
Description: Structure-based rational drug design: Crystal structure of the complex formed between Phospholipase A2 and a pentapeptide Val-Ala-Phe-Arg-Ser
Class: hydrolase
Keywords: rational drug design, vafrs complex, phospholipase a2, hydrolase
Deposited on 2004-03-04, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • GB AAB47213 (0-49)
    Domains in SCOPe 2.07: d1skga_
  • Chain 'B':
    Compound: vafrs
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1SKG (0-4)
  • Heterogens: SO4, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1skgA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    No sequence available.