PDB entry 1skg

View 1skg on RCSB PDB site
Description: Structure-based rational drug design: Crystal structure of the complex formed between Phospholipase A2 and a pentapeptide Val-Ala-Phe-Arg-Ser
Class: hydrolase
Keywords: rational drug design, vafrs complex, phospholipase a2, hydrolase
Deposited on 2004-03-04, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • GB AAB47213 (0-49)
  Domains in SCOPe 2.08: d1skga_
• Chain 'B':
  Compound: vafrs
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1SKG (0-4)
• Heterogens: SO4, MOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1skgA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  No sequence available.