PDB entry 1skf

View 1skf on RCSB PDB site
Description: crystal structure of the streptomyces k15 dd-transpeptidase
Class: penicillin-binding
Keywords: penicillin-binding, dd-transpeptidase, serine peptidase, beta-lactamase, hydrolase carboxypeptidase
Deposited on 1998-08-20, released 1999-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine transpeptidase
    Species: Streptomyces sp. [TaxId:1958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39042 (0-261)
      • conflict (70-71)
      • conflict (112-113)
      • conflict (155)
    Domains in SCOPe 2.08: d1skfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1skfA (A:)
    vtkptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiq
    kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
    figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
    aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
    astsiparesdatkimnygfal