PDB entry 1ska

View 1ska on RCSB PDB site
Description: Crystallographic snapshots of Aspergillus fumigatus phytase revealing its enzymatic dynamics
Class: hydrolase
Keywords: small alpha domain, big alpha/beta domain, catalytic sites, water structures, catalytic dynamics, product release pathway, HYDROLASE
Deposited on 2004-03-04, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.158
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phytase A
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1skaa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1skaA (A:)
    skscdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryp
    tsskskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqry
    kalarsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnn
    tldhgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdt
    vartsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarlt
    rspvqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsves
    akeldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklnd
    fvkglswarsggnwgecfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skaA (A:)
    cdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryptss
    kskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqrykal
    arsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnntld
    hgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdtvar
    tsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarltrsp
    vqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsvesake
    ldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklndfvk
    glswarsggnwgecf