PDB entry 1sk7

View 1sk7 on RCSB PDB site
Description: Structural Basis for Novel Delta-Regioselective Heme Oxygenation in the Opportunistic Pathogen Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: heme oxygenase, heme degradation, regioselectivity, OXIDOREDUCTASE
Deposited on 2004-03-04, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.235
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein pa-HO
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pigA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sk7a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sk7A (A:)
    mdtlapestrqnlrsqrlnlltnephqrleslvkskepfasrdnfarfvaaqylfqhdle
    plyrnealarlfpglasrarddaaradladlghpvpegdqsvreadlslaealgwlfvse
    gsklgaaflfkkaaaleldenfgarhlaepeggraqgwksfvaildgielneeeerlaak
    gasdafnrfgdllertfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sk7A (A:)
    nlrsqrlnlltnephqrleslvkskepfasrdnfarfvaaqylfqhdleplyrnealarl
    fpglasrarddaaradladlghpvpegdqsvreadlslaealgwlfvsegsklgaaflfk
    kaaaleldenfgarhlaepeggraqgwksfvaildgielneeeerlaakgasdafnrfgd
    llertfa