PDB entry 1sk4

View 1sk4 on RCSB PDB site
Description: crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
Deposited on 2004-03-04, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sk4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sk4A (A:)
    pniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrnfc
    digyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqdli
    qcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh