PDB entry 1sk4

View 1sk4 on RCSB PDB site
Description: crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha
Class: immune system
Keywords: alpha/beta mix, IMMUNE SYSTEM
Deposited on 2004-03-04, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidoglycan recognition protein I-alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: PGRPIA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96LB9 (0-162)
    • modified residue (121)
  Domains in SCOPe 2.08: d1sk4a_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sk4A (A:)
  pniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrnfc
  digyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqdli
  qcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh